Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource  rightarrow Monoclonal Antibody Blog  rightarrow ACTH blocking peptide  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Blogs moreseparator
separator
 • anti-AQP4 antibody blog
 • anti-TLR8 antibody blog
 • anti-PEX6 antibody blog
 • anti-TNFa antibody blog
 • anti-TOB2 antibody blog
 • anti-EPHA2 antibody blog
 • anti-IL-1alpha antibody blog
 • anti-ACPP  antibody blog
 • anti-IL-17 receptor antibody blog
 • anti-SERPINE1 antibody blog
 • anti-CD32 antibody blog
 • anti-RBP4 antibody blog
 • anti-GS antibody blog
 • anti-FGF2 antibody blog
 • anti-GSTM1 antibody blog
 • anti-CD8/Lyt2 antibody blog
 • anti-TNFa antibody blog
 • anti-HK2 antibody blog
 • anti-Ig kappa antibody blog
 • anti-CD35 antibody blog
separator
Blog Categories separator
separator
 • Assay Kit Blogs
 • Biochemical Blogs
 • cDNA Clone Blogs
 • Monoclonal Antibody Blogs
 • Polyclonal Antibody Blogs
 • Rec/Purified Protein Blogs
 • Popular Product Blogs
separator
Our Best Sellers moreseparator
separator
 • EPCA2 (Early Prostate Cancer Antigen 2) ELISA Kit
 • Inter Alpha-Globulin Inhibitor H5 (ITIH5) ELISA Kit
 • Proprotein Convertase 2 (PCSK2) Antibody
 • Egl nine homolog 2 Antibody
 • TAu Recombinant Protein
 • Growth Arrest Specific Protein 6 (GAS6) Recombinant Protein
 • Succinate dehydrogenase cytochrome b560 subunit, mitochondri... ELISA Kit
 • Pepsin (PP) ELISA Kit
 • serpin peptidase inhibitor, clade I (pancpin) , member 2 (SE... ELISA Kit
 • DNER Recombinant Protein
 • Calcitonin Gene Related Peptide (CGRP) ELISA Kit
 • 12-Lipoxygenase (LOX-12) ELISA Kit
 • Acetyl Coenzyme A Carboxylase Alpha (ACACA) ELISA Kit
 • TNFR1 (TNFRSF1A) Antibody
 downarrow more ...
separator

ACTH blocking peptide product blog

separator
Posted on 2017-03-03 21:12:19 by mybiosource_staff
Share it on ...     
separator
separator
Tags: ACTH; Blocking Peptide; ACTH blocking peptide;
separator
The ACTH n/a (Catalog #MBS542334) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. MyBioSource\'s ACTH can be used in a range of immunoassay formats including, but not limited to, Immmunodepletion, Competition Assay.
Confocal Microscopy: 1:250
Immunocytochemistry: 1:250
Immunofluorescence: 1:200
Immunohistochemistry: 1:250
Western Blot: 1:1,000. Researchers should empirically determine the suitability of the ACTH n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.

The ACTH n/a product has the following accession number(s) (GI #60829907) (NCBI Accession #AAX36901). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.

To buy or view more detailed product information and pricing, please click on the technical datasheet page below:


Stimulates adrenal glands and release cortisol.

ACTH n/a

Immunogen: Synthetic peptide corresponding to ACTH aa 138-176.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Expression: ACTH and MSH are produced by the pituitary gland. Molecular Function: GPCR; Hormone activity
Structure: Belongs to POMC family
Subcellular Location: Secreted.
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions