anti-Brain Natriuretic Peptide, aa1-32 antibody product blog
Tags: Antibody; Monoclonal Antibody; Brain Natriuretic Peptide, aa1-32; anti-Brain Natriuretic Peptide, aa1-32 antibody;
The Brain Natriuretic Peptide, aa1-32 n/a (Catalog #MBS644585) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Brain Natriuretic Peptide, aa1-32 (BNP) reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s Brain Natriuretic Peptide, aa1-32 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA).Suitable for use in ELISA. Researchers should empirically determine the suitability of the Brain Natriuretic Peptide, aa1-32 n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The Brain Natriuretic Peptide, aa1-32 n/a product has the following accession number(s) (GI #4433127) (NCBI Accession #BAA04067.1). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Human brain natriuretic peptide (BNP) is a secreted protein which is a member of the natriuretic peptide family. BNP is a cardiac hormone, which is synthesized as a pro-hormone (proBNP), and is proteolytically cleaved to release a biologically active fragment (BNP), and an inactive fragment (NT-proBNP) into the circulation.
BNP is predominantly secreted from the cardiac ventricles in response to volume and pressure overload, and results in a number of biological activities including natriuresis, diuresis, vasorelaxation, and inhibition of the sympathetic nervous system. A high concentration of BNP in the bloodstream is indicative of heart failure.
Immunogen: Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH). In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Brain Natriuretic Peptide, aa1-32 are readily searchable from our website. Different antibodies against the same target such as Brain Natriuretic Peptide, aa1-32 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.