anti-Itga3 antibody product blog
Tags: Antibody; Monoclonal Antibody; anti-ITGA3 antibody; ITGA3; Integrin alpha 3A;
The Itga3 itga3 (Catalog #MBS570166) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Mouse anti Integrin alpha 3A reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s Integrin alpha 3A can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB).29A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titRation; recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting appliCations. Researchers should empirically determine the suitability of the Itga3 itga3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The Itga3 itga3 product has the following accession number(s) (GI #8178480) (NCBI Accession #AAB20356.2) (Uniprot Accession #Q62470). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the Mouse anti Integrin alpha 3A with the following immunoassay(s):
Testing Data (Figure 1: Immunohistochemistry on frozen section of human kidney )
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, An and B, have been identified.
Source Note: 29A3 is a Mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. Reactivity Note: A broad species reactivity is expected because of the conserved nature of the epitope. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing Itga3 are readily searchable from our website. Different antibodies against the same target such as Itga3 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.