anti-NSE antibody product blog
Tags: Antibody; NSE; Monoclonal Antibody; anti-NSE antibody; Enolase, Neuron Specific (NSE);
The NSE n/a (Catalog #MBS2043560) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APC/CY7-Linked Monoclonal Antibody to Enolase, Neuron Specific (NSE) reacts with Human and may cross-react with other species as described in the data sheet. MyBioSource\'s Enolase, Neuron Specific (NSE) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC), Immunoprecipitation (IP), ELISA (EIA). Researchers should empirically determine the suitability of the NSE n/a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
Conjugation: APC-Cy7
Cross Reactivity: Human, Mouse. Unconjugated Antibody: The unconjugated antibody version of this item is also available as catalog #MBS2025648. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing NSE are readily searchable from our website. Different antibodies against the same target such as NSE may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results.