MAP3K1 antibody product blog
Tags: Antibody; MAP3K1; MAP3K1 antibody;
The MAP3K1 map3k1 (Catalog #MBS439590) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Mouse Monoclonal Antibody reacts with Human. Others not known and may cross-react with other species as described in the data sheet. MyBioSource\'s MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), Immunofluorescence (IF), Western Blot (WB), Immunohistochemistry (IHC) Formalin.Western Blot (0.5-1ug/ml)
Immunohistochemistry (Formalin-fixed) (0.5-1.0ug/ml for 30 minutes at RT) (Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined. Researchers should empirically determine the suitability of the MAP3K1 map3k1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
The MAP3K1 map3k1 product has the following accession number(s) (GI #153945765) (NCBI Accession #NP_005912.1) (Uniprot Accession #Q13233). Researchers may be interested in using Bioinformatics databases such as those available at The National Center for Biotechnology Information (NCBI) website for more information about accession numbers and the proteins they represent. Even researchers unfamiliar with bioinformatics databases will find the NCBI databases to be quite user friendly and useful.
To buy or view more detailed product information and pricing, please click on the technical datasheet page below:
Please refer to the product datasheet for known applications of a given antibody. We\'ve tested the MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Mouse Monoclonal Antibody with the following immunoassay(s):
Immunohistochemistry (IHC) (Formalin-fixed, paraffin-embedded human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)
Immunohistochemistry (IHC) (Formalin-fixed, paraffin-embedded human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)
Immunohistochemistry (IHC) (Formalin-fixed, paraffin-embedded human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)
Cellular Localization: Cytoplasmic
Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK). Hu-Chromosome Location: 5q11.2
Positive Control: A431, HeLa or HL-60 cells or liver tissue. In general, we may offer more than one antibody to a given target to enable options for the researcher. Available antibodies recognizing MAP3K1 are readily searchable from our website. Different antibodies against the same target such as MAP3K1 may be optimized or tested for different applications and species. This enables researchers to select the option that may be best for their model system, to screen more than antibody to determine which one may be best for their model system, as well as to use more than one antibody to follow up on and validate their results. Adenocarcinoma, Breast Neoplasms, Carcinoma, Cell Transformation, Neoplastic, Inflammation, Liver Diseases, Liver Neoplasms, Necrosis, Neoplasm Invasiveness, Ovarian Neoplasms are some of the diseases may be linked to MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Mouse Monoclonal Antibody.